Overview

  • Product name

    Anti-RAB43 antibody
  • Description

    Mouse monoclonal to RAB43
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RAB43 aa 113-211.
    Sequence:

    IEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETS AKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC

  • General notes

    This product was changed from ascites to tissue culture supernatant on 11th June 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab58030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 23 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Tissue specificity

    Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • RAB41 antibody
    • RAB43 antibody
    • RAB43_HUMAN antibody
    • Ras related protein Rab 41 antibody
    • Ras related protein Rab 43 antibody
    • Ras-related protein Rab-41 antibody
    • Ras-related protein Rab-43 antibody
    see all

Images

  • RAB43 antibody (ab58030) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human salivary gland.

    This image was generated using the ascites version of the product.

  • RAB43 antibody (ab58030) at 1ug/lane + HepG2 cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Han MZ  et al. High expression of RAB43 predicts poor prognosis and is associated with epithelial-mesenchymal transition in gliomas. Oncol Rep 37:903-912 (2017). Read more (PubMed: 28075478) »
  • Rhee M  et al. Preadipocyte factor 1 induces pancreatic ductal cell differentiation into insulin-producing cells. Sci Rep 6:23960 (2016). Read more (PubMed: 27044861) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab58030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up