Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab5b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Rab5b aa 1-215.
    Sequence:

    MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE STIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVY DITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQA YADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVD LHEQSQQNKSQCCSN


    Database link: P61020

  • Positive control

    • WB: A431, HeLa, Jurkat, HEK-293T and HepG2 whole cell lysates. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 24 kDa (predicted molecular weight: 24 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Rab5b is a member of the Rab family of small (monomeric) G proteins. Like other small G proteins, Rab5b switches between an inactive, GDP-form and an active, GTP-bound form. GDP/GTP exchange factors (GEFs) catalyse the conversion from the GDP-bound form to the GTP-bound form, while GTPase-activating proteins (GAPs) catalyse GTP hydrolysis to GDP. Rab5b is involved in endocytosis and recycling of cell surface molecules. It interacts with RIN2 and RIN3, which regulate its function, possibly by acting as GEFs. Knockdown of Rab5b abolished group I metabotropic glutamate receptor (mGluR)-mediated neuroprotection. Furthermore, Rab5b interacts with LRRK2, the defective gene at the PARK8 locus that results in Parkinson's disease. Roles for Rab5b in neurodegenerative disease, neuroprotection, and synaptic plasticity have been suggested.
  • Cellular localization

    Cell Membrane, Endosome
  • Database links

  • Alternative names

    • Rab 5b antibody
    • Rab5 b antibody
    • RAB5B, member RAS oncogene family antibody
    • Ras related protein Rab 5B antibody
    • RAS-associated protein RAB5B antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for Rab5b using ab230000 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-Rab5b antibody (ab230000) at 1/1000 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 24 kDa
    Observed band size: 24 kDa

References

ab230000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up