Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB6B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RAB6B aa 31-193. (BC002510)
    Sequence:

    TRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIP SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDL ADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENV QEKSKEGMIDIKL


    Database link: Q9NRW1

  • Positive control

    • Recombinant Human RAB6B protein, Human fetal tonsil tissue.
  • General notes

    We have not tested this product against RAB6A. ab206110 may cross react with RAB6A.

Properties

Applications

Our Abpromise guarantee covers the use of ab206110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 23 kDa.

Target

  • Function

    Seems to have a role in retrograde membrane traffic at the level of the Golgi complex. May function in retrograde transport in neuronal cells.
  • Tissue specificity

    Predominantly expressed in brain.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Golgi apparatus membrane. Cytoplasmic vesicle. Colocalizes with BICD1 at vesicular structures that align along microtubules.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9630015C03 antibody
    • AI844641 antibody
    • C330006L04Rik antibody
    • D9Bwg0185e antibody
    • OTTHUMP00000216372 antibody
    • RAB6B antibody
    • RAB6B member RAS oncogene family antibody
    • RAB6B_HUMAN antibody
    • Ras related protein Rab 6B antibody
    • Ras-related protein Rab-6B antibody
    • Small GTP binding protein antibody
    • Small GTPase RAB6B antibody
    see all

Images

  • Anti-RAB6B antibody (ab206110) at 1/500 dilution + Human RAB6B recombinant protein

    Predicted band size: 23 kDa

  • Immunohistochemical analysis of formalin/-fixed, paraffin-embedded section of Human fetal tonsil tissue labeling RAB6B with ab206110 at a 1/100 dilution.

References

This product has been referenced in:

  • Spinelli C  et al. Molecular subtypes and differentiation programmes of glioma stem cells as determinants of extracellular vesicle profiles and endothelial cell-stimulating activities. J Extracell Vesicles 7:1490144 (2018). Read more (PubMed: 30034643) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up