Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB8B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RAB8B aa 154-207.
    Sequence:

    SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFR CSLL


    Database link: Q92930

  • Positive control

    • WB: Human tonsil tissue lysates; RT4 and U-251 MG cell lysates. ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 24 kDa.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for RAB8B (green) using ab222017 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-RAB8B antibody (ab222017) at 1/500 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 24 kDa

References

ab222017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up