Anti-Rab9 antibody (ab235538)
Key features and details
- Rabbit polyclonal to Rab9
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Rab9 antibody
See all Rab9 primary antibodies -
Description
Rabbit polyclonal to Rab9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Dog -
Immunogen
Recombinant fragment corresponding to Human Rab9 aa 122-201.
Sequence:LGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRR VLATEDRSDHLIQTDTVNLHRKPKPSSSCC
Database link: P51151 -
Positive control
- WB: Jurkat, K562, HepG2, HEK-293T and HeLa whole cell lysate. IHC-P: Human prostate cancer and adrenal gland tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235538 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. |
Target
-
Function
Involved in the transport of proteins between the endosomes and the trans Golgi network. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 403947 Dog
- Entrez Gene: 9367 Human
- Entrez Gene: 56382 Mouse
- Entrez Gene: 84589 Rat
- Omim: 300284 Human
- SwissProt: P24408 Dog
- SwissProt: P51151 Human
- SwissProt: Q9R0M6 Mouse
see all -
Alternative names
- 2410064E05Rik antibody
- AI195561 antibody
- DmRab9 antibody
see all
Images
-
All lanes : Anti-Rab9 antibody (ab235538) at 1/1000 dilution
Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 4 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 5 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab9 antibody (ab235538)
Paraffin-embedded human prostate cancer tissue stained for Rab9 with ab235538 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab9 antibody (ab235538)
Paraffin-embedded human adrenal gland tissue stained for Rab9 with ab235538 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab235538 has not yet been referenced specifically in any publications.