Anti-Rab9 antibody (ab235538)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Rab9 antibody
See all Rab9 primary antibodies -
Description
Rabbit polyclonal to Rab9 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Dog
-
Immunogen
Recombinant fragment corresponding to Human Rab9 aa 122-201.
Sequence:LGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRR VLATEDRSDHLIQTDTVNLHRKPKPSSSCC
Database link: P51151 -
Positive control
- WB: Jurkat, K562, HepG2, HEK-293T and HeLa whole cell lysate. IHC-P: Human prostate cancer and adrenal gland tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235538 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. |
Target
-
Function
Involved in the transport of proteins between the endosomes and the trans Golgi network. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 403947 Dog
- Entrez Gene: 9367 Human
- Entrez Gene: 56382 Mouse
- Entrez Gene: 84589 Rat
- Omim: 300284 Human
- SwissProt: P24408 Dog
- SwissProt: P51151 Human
- SwissProt: Q9R0M6 Mouse
see all -
Alternative names
- 2410064E05Rik antibody
- AI195561 antibody
- DmRab9 antibody
see all
Images
-
Western blot - Anti-Rab9 antibody (ab235538)All lanes : Anti-Rab9 antibody (ab235538) at 1/1000 dilution
Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 2 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 4 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 5 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab9 antibody (ab235538)Paraffin-embedded human prostate cancer tissue stained for Rab9 with ab235538 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab9 antibody (ab235538)Paraffin-embedded human adrenal gland tissue stained for Rab9 with ab235538 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab235538 has not yet been referenced specifically in any publications.
