Rabbit Polyclonal to TBC1D19 (ab243578)
Key features and details
- Rabbit Polyclonal to TBC1D19
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Rabbit Polyclonal to TBC1D19
See all TBC1D19 primary antibodies -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TBC1D19 aa 181-264.
Sequence:HLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVR IGQKVLAEQDSAAAQQYIRQGSPTALRAELWALI
Database link: Q8N5T2 -
Positive control
- IHC-P: Human pancreas tissue. WB: RT4 and U-251 MG cell lysate. ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243578 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May act as a GTPase-activating protein for Rab family protein(s). -
Sequence similarities
Contains 1 Rab-GAP TBC domain. - Information by UniProt
-
Database links
- Entrez Gene: 55296 Human
- SwissProt: Q8N5T2 Human
- Unigene: 479403 Human
-
Alternative names
- 2810453K03Rik antibody
- FLJ11082 antibody
- RGD1304958 antibody
see all
Images
-
PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling TBC1D19 using ab243578 at 4 µg/ml (green) in ICC/IF analysis.
-
All lanes : Rabbit Polyclonal to TBC1D19 (ab243578) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Rabbit Polyclonal to TBC1D19 (ab243578)
Formalin-fixed, paraffin-embedded human pancreas tissue stained for TBC1D19 with ab243578 at a 1/50 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243578 has not yet been referenced specifically in any publications.