Rabbit Polyclonal to TBC1D19 (ab243578)
- Datasheet
- References
- Protocols
Overview
-
Product name
Rabbit Polyclonal to TBC1D19
See all TBC1D19 primary antibodies -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TBC1D19 aa 181-264.
Sequence:HLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVR IGQKVLAEQDSAAAQQYIRQGSPTALRAELWALI
Database link: Q8N5T2 -
Positive control
- IHC-P: Human pancreas tissue. WB: RT4 and U-251 MG cell lysate. ICC/IF: U-251 MG cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243578 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May act as a GTPase-activating protein for Rab family protein(s). -
Sequence similarities
Contains 1 Rab-GAP TBC domain. - Information by UniProt
-
Database links
- Entrez Gene: 55296 Human
- SwissProt: Q8N5T2 Human
- Unigene: 479403 Human
-
Alternative names
- 2810453K03Rik antibody
- FLJ11082 antibody
- RGD1304958 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Rabbit Polyclonal to TBC1D19 (ab243578)PFA fixed, Triton X-100 permeabilized U-251 MG (Human brain glioma cell line) cells labeling TBC1D19 using ab243578 at 4 µg/ml (green) in ICC/IF analysis.
-
Western blot - Rabbit Polyclonal to TBC1D19 (ab243578)All lanes : Rabbit Polyclonal to TBC1D19 (ab243578) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Rabbit Polyclonal to TBC1D19 (ab243578)Formalin-fixed, paraffin-embedded human pancreas tissue stained for TBC1D19 with ab243578 at a 1/50 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243578 has not yet been referenced specifically in any publications.
