Overview

  • Product name

  • Description

    Rabbit polyclonal to RABEP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human RABEP2 aa 353-402.
    Sequence:

    SQAQERVQLQMAELVTTHKCLHHEVKRLNEENQGLRAEQLPSSAPQGSQQ


    Database link: Q9H5N1

  • Positive control

    • Human colon tissue. Extracts from HeLa, Jurkat, 293 and HUVEC cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab190003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 64 kDa.

Target

Images

  • All lanes : Anti-RABEP2 antibody (ab190003) at 1/500 dilution

    Lane 1 : Extracts from HeLa cells
    Lane 2 : Extracts from Jurkat cells
    Lane 3 : Extracts from 293 cells
    Lane 4 : Extracts from HUVEC cells
    Lane 5 : Extracts from HeLa cells with synthesized peptide

    Predicted band size: 64 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon sections labeling RABEP2 with ab190003 at 10 µg/ml.

References

This product has been referenced in:

  • Kofler N  et al. The Rab-effector protein RABEP2 regulates endosomal trafficking to mediate vascular endothelial growth factor receptor-2 (VEGFR2)-dependent signaling. J Biol Chem 293:4805-4817 (2018). Read more (PubMed: 29425100) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up