Overview

  • Product name

  • Description

    Rabbit polyclonal to RABGAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RABGAP1 aa 216-252.
    Sequence:

    RICQQHTKDISERQARFSSQSGETGEVQACPDKRYAM


    Database link: H9NIL4

  • Positive control

    • IHC-P: Human thyroid gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    May act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition.
  • Cellular localization

    Cytoplasm, cytosol. Centrosome
  • Database links

  • Alternative names

    • GAP and centrosome associated protein antibody
    • GAPCENA antibody
    • HSPC094 antibody
    • Rab GTPase activating protein 1 antibody
    • Rab6 GTPase activating protein GAPCenA antibody
    • RP11-123N4.2 antibody
    • TBC1 domain family member 11 antibody
    • TBC1D11 antibody
    see all

Images

  • Paraffin-embedded human thyroid gland tissue stained for RABGAP1 using ab243466 at 1/50 dilution in immunohistochemical analysis.

References

ab243466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up