Overview

  • Product name

  • Description

    Rabbit polyclonal to RABGGTA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RABGGTA aa 1-200.
    Sequence:

    MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLE LTSQILGANPDFATLWNCRREVLQQLETQKSPEELAALVKAELGFLESCL RVNPKSYGTWHHRCWLLGRLPEPNWTRELELCARFLEVDERNFHCWDYRR FVATQAAVPPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQ


    Database link: Q92696

  • Positive control

    • WB: HEK-293 whole cell lysate; Mouse kidney tissue lysate. IHC-P: Human lung and kidney tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/100 - 1/500.
ICC/IF 1/50 - 1/500.

Target

Images

  • All lanes : Anti-RABGGTA antibody (ab237515) at 1/500 dilution

    Lane 1 : HEK-293 (Human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human lung tissue stained for RABGGTA using ab237515 at 1/150 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human kidney tissue stained for RABGGTA using ab237515 at 1/150 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for RABGGTA (green) at 1/100 dilution in ICC/IF analysis, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab237515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up