Overview

  • Product name

    Anti-Rabies Virus Glycoprotein antibody (FITC)
    See all Rabies Virus Glycoprotein primary antibodies
  • Description

    Rabbit polyclonal to Rabies Virus Glycoprotein (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Other species
  • Immunogen

    Recombinant fragment corresponding to Rabies Virus Glycoprotein aa 20-459.
    Sequence:

    KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGY ILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNW KMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLH SRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRA SKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETK WCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRR LSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGR CHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLA DPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY


    Database link: P03524

Properties

Applications

Our Abpromise guarantee covers the use of ab193407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/100. Predicted molecular weight: 59 kDa.

Target

  • Relevance

    The rabies virus is neurotrophic virus that causes fatal disease in human and animals. Rabies transmission can occur through the saliva of animals. It has a cylindrical morophology and is the type species of the Lyssavirus genus of the Rhabdoviridae family. These viruses are enveloped and have a single stranded RNA genome with negative-sense. The rabies virus is a member of the Lyssavirus genus. This genus of RNA viruses also includes the Aravan virus, Australian bat lyssavirus, Duvenhage virus, European bat lyssavirus 1, European bat lyssavirus 2, Irkut virus, Khujand virus, Lagos bat virus, Mokola virus and the West Caucasian bat virus. Together with the Vesiculovirus and others they form the Rhabdoviridae family.
  • Cellular localization

    Virion membrane; Single-pass type I membrane protein
  • Alternative names

    • Glycoprotein G antibody

References

ab193407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up