Overview

  • Product name

    Anti-RABIF antibody
  • Description

    Rabbit polyclonal to RABIF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RABIF aa 1-119. BC018488
    Sequence:

    MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRK KPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIG PIGWHCLDDKNSFYVALER


    Database link: P47224

  • Positive control

    • HL60 and HT29 cell lysates; Human fetal colon tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL of sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 14 kDa.

Target

  • Relevance

    RABIF belongs to the DSS4/MSS4 family. It is a guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. It stimulates GDP release from both YPT1 and RAB3A, but is less active on these proteins than on the SEC4 protein. RABIF might play a general role in vesicular transport. Ubiquitously expressed.
  • Database links

  • Alternative names

    • Guanine nucleotide exchange factor MSS4 antibody
    • Mammalian suppressor of SEC4 antibody
    • MSS4 antibody
    • RAB interacting factor antibody
    • Ras specific guanine releasing factor 3 antibody
    • RASGFR3 antibody
    • RASGRF3 antibody
    see all

Images

  • All lanes : ChIP Kit (ab500) at 1/205029 dilution

    Lane 1 : HL60 cell lysate
    Lane 2 : HL29 cell lysate

    Predicted band size: 14 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human fetal colon tissue labeling RABIF with ab205029 at a 1/100 dilution.

References

ab205029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up