Overview

  • Product name

  • Description

    Rabbit polyclonal to RABIN8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RABIN8 aa 4-191. Genbank: BC059358
    Sequence:

    PLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQ ANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTK LTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVR EKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQ


    Database link: Q96QF0

  • Positive control

    • Human fetal heart and kidney lysates. Human fetal pancreas tissue.
  • General notes

     This product was previously labelled as RAB3IP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab197206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 34 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis.
  • Tissue specificity

    Expressed in brain, kidney, heart, pancreas and placenta. Not detected in skeletal muscle or liver.
  • Sequence similarities

    Belongs to the SEC2 family.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Predominantly cytoplasmic but a small proportion colocalizes with SSX2 in the nucleus. Activation of protein kinase C results in redistribution to the periphery of lamellipodia. In the cytoskeleton, localizes to cortical actin.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gtpat12 antibody
    • Rab-3A-interacting protein antibody
    • RAB3A interacting protein antibody
    • RAB3A interacting protein (rabin3) antibody
    • RAB3A interacting protein antibody
    • RAB3A-interacting protein antibody
    • RAB3I_HUMAN antibody
    • Rab3ip antibody
    • Rabin 3 antibody
    • Rabin-3 antibody
    • RABIN3 antibody
    • RABIN3, rat, homolog of antibody
    • Rabin8 antibody
    • SSX2 interacting protein antibody
    • SSX2 interacting protein antibody
    • SSX2-interacting protein antibody
    see all

Images

  • All lanes : Anti-RABIN8 antibody (ab197206) at 1/500 dilution

    Lane 1 : Human fetal kidney lysate
    Lane 2 : Human fetal heart lysate

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human fetal pancreas tissue labeling RABIN8 with ab197206 at a 1/100 dilution.

References

ab197206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up