Overview

  • Product name

    Anti-RABL2 antibody
  • Description

    Rabbit polyclonal to RABL2
  • Host species

    Rabbit
  • Specificity

    ab192347 detects endogenous levels of RABL2A and RABL2B protein.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human RABL2A aa 1-228.
    Sequence:

    MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQ LSTYALTLYK HTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACI MVFDIQRKVTYRNLSTWYTELR EFRPEIPCIVVANKIDDINVTQKSFN FAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSY KQNSQDFMDEIFQE LENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS


    Database link: Q9UBK7

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 26 kDa.

Target

References

ab192347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up