Overview

  • Product name

  • Description

    Rabbit polyclonal to RABL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RABL4 aa 92-181.
    Sequence:

    TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAW ALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV


    Database link: Q9BW83

  • Positive control

    • WB: RABL4 overexpression HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 20 kDa.

Target

  • Function

    Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 (PubMed:25443296). Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 (PubMed:25443296). Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25.
  • Involvement in disease

    Bardet-Biedl syndrome 19
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell projection, cilium.
  • Information by UniProt
  • Database links

  • Alternative names

    • BBS19 antibody
    • Ift27 antibody
    • IFT27_HUMAN antibody
    • Intraflagellar transport 27 antibody
    • Intraflagellar transport protein 27 homolog antibody
    • Putative GTP binding protein RAY like antibody
    • Putative GTP-binding protein RAY-like antibody
    • Rab like protein 4 antibody
    • RAB member of RAS oncogene family like 4 antibody
    • Rab-like protein 4 antibody
    • RAYL antibody
    see all

Images

  • All lanes : Anti-RABL4 antibody (ab224408) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : RABL4 overexpression HEK-293T (co-expressed with a C terminal myc-DDK tag, ~3.1 kDa) cell lysate

    Predicted band size: 20 kDa

References

ab224408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up