Overview

  • Product name

    Anti-RABL5 antibody
  • Description

    Rabbit polyclonal to RABL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RABL5 aa 1-87.
    Sequence:

    MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTS NNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIV


    Database link: Q9H7X7

  • Positive control

    • WB: RABL5 overexpression HEK-293T cell lysate. IHC-P: Human testis tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 21 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3110017O03Rik antibody
    • AI835745 antibody
    • AI847427 antibody
    • DKFZp761N0823 antibody
    • FLJ13225 antibody
    • FLJ14117 antibody
    • MGC109244 antibody
    • RAB member of RAS oncogene family like 5 antibody
    • RAB member RAS oncogene family like 5 antibody
    • Rab-like protein 5 antibody
    • RABL5 antibody
    • RABL5_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for RABL5 (green) using ab243807 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-RABL5 antibody (ab243807) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : RABL5 overexpression HEK-293T cell lysate

    Predicted band size: 21 kDa

  • Formalin-fixed, paraffin-embedded human testis tissue stained for RABL5 using ab243807 at 1/200 dilution in immunohistochemical analysis.

References

ab243807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up