Anti-RAC3 antibody (ab230089)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RAC3 antibody
See all RAC3 primary antibodies -
Description
Rabbit polyclonal to RAC3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Dog
-
Immunogen
Recombinant full length protein corresponding to Human RAC3 aa 1-192.
Sequence:MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG SVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Database link: P60763 -
Positive control
- IHC-P: Human heart tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230089 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner. -
Tissue specificity
Highest levels in brain, also detected in heart, placenta and pancreas. -
Sequence similarities
Belongs to the small GTPase superfamily. Rho family. -
Post-translational
modifications(Microbial infection) Glycosylated at Tyr-32 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of Rac and leads to actin disassembly. -
Cellular localization
Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery. - Information by UniProt
-
Database links
- Entrez Gene: 5881 Human
- Entrez Gene: 170758 Mouse
- Omim: 602050 Human
- SwissProt: P60763 Human
- SwissProt: P60764 Mouse
- Unigene: 45002 Human
- Unigene: 34008 Mouse
-
Form
Rac3 has high sequence homology with other Rac proteins. Therefore some antibodies may show cross-reactivity. -
Alternative names
- OTTMUSP00000004488 antibody
- p21 Rac3 antibody
- p21-Rac3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAC3 antibody (ab230089)Paraffin-embedded human heart tissue stained for RAC3 using ab230089 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab230089 has not yet been referenced specifically in any publications.
