Overview

  • Product name

  • Description

    Rabbit polyclonal to Rad1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Rad1 aa 1-282.
    Sequence:

    MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIK VTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSP MPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPEETLDFDFCST NVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSH LDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGF LSLQYMIRNEDGQICFVEYYCCPDEEVPESES


    Database link: O60671-1

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. Isoform 1 possesses 3'->5' double stranded DNA exonuclease activity.
  • Tissue specificity

    Expressed in testis, uterus, bladder, spleen, ovaries, lung, brain and muscle (at protein level).
  • Sequence similarities

    Belongs to the rad1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell cycle checkpoint protein Hrad1 antibody
    • Cell cycle checkpoint protein Rad 1 A / B antibody
    • Cell cycle checkpoint protein RAD1 antibody
    • Checkpoint control protein HRAD1 antibody
    • Checkpoint control protein RAD1 antibody
    • DNA repair exonuclease antibody
    • DNA repair exonuclease rad1 antibody
    • DNA repair exonuclease rad1 homolog antibody
    • DNA repair exonuclease REC1 antibody
    • DNA repair protein RAD1 antibody
    • EC 3.1.11.2 antibody
    • Exonuclease homolog RAD1 antibody
    • GTP-binding protein RAD antibody
    • hRAD 1 antibody
    • hRAD1 antibody
    • MGC77779 antibody
    • RAD 1 antibody
    • RAD antibody
    • RAD1 antibody
    • RAD1 homolog (S. pombe) antibody
    • RAD1 homolog antibody
    • Rad1 like DNA damage checkpoint antibody
    • Rad1 like DNA damage checkpoint protein antibody
    • RAD1, S. pombe, homolog of antibody
    • Rad1-like DNA damage checkpoint protein antibody
    • RAD1_HUMAN antibody
    • Ras associated with diabetes antibody
    • REC 1 antibody
    • REC1 antibody
    • RRAD antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for Rad1 using ab238584 at 1/100 dilution in immunohistochemical analysis.

References

ab238584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up