Anti-Rad51 antibody (ab176458)
Key features and details
- Rabbit polyclonal to Rad51
- Suitable for: WB, IP, ICC/IF, IHC-P
- Reacts with: Mouse, Human, Xenopus laevis, Chinese hamster
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-Rad51 antibody
See all Rad51 primary antibodies -
Description
Rabbit polyclonal to Rad51 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human, Xenopus laevis, Chinese hamster
Predicted to work with: Rabbit, Cow, Dog -
Immunogen
Recombinant full length protein corresponding to Human Rad51 aa 1-339.
Sequence:MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVE AVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDR GGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQ TQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLR MLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Database link: Q06609 -
Positive control
- WB: MCF7, CHO, NIH3T3 and Xenopus laevis eggs cell lysates
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.00
Constituents: 50% Glycerol (glycerin, glycerine), 50% PBS
Azide and carrier free. -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
ChIP Related Products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176458 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (3) |
1/1000 - 1/10000. Predicted molecular weight: 36 kDa.
|
IP |
1/100 - 1/1000.
|
|
ICC/IF |
1/1000 - 1/10000.
|
|
IHC-P |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/1000 - 1/10000. Predicted molecular weight: 36 kDa. |
IP
1/100 - 1/1000. |
ICC/IF
1/1000 - 1/10000. |
IHC-P
Use at an assay dependent concentration. |
Target
-
Function
Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination. Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange (PubMed:26681308). Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. -
Tissue specificity
Highly expressed in testis and thymus, followed by small intestine, placenta, colon, pancreas and ovary. Weakly expressed in breast. -
Involvement in disease
Breast cancer
Mirror movements 2
Defects in RAD51 are found in a patient with microcephaly, mental retardation without bone marrow failure and pediatric cancers. -
Sequence similarities
Belongs to the RecA family. RAD51 subfamily.
Contains 1 HhH domain. -
Domain
The nuclear localization may reside in the C-terminus (between 259 and 339 AA). -
Post-translational
modificationsUbiquitinated by the SCF(FBXO18) E3 ubiquitin ligase complex, regulating RAD51 subcellular location and preventing its association with DNA.
Phosphorylated. Phosphorylation of Thr-309 by CHEK1 may enhance association with chromatin at sites of DNA damage and promote DNA repair by homologous recombination. Phosphorylation by ABL1 inhibits function. -
Cellular localization
Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Mitochondrion matrix. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Colocalizes with RAD51AP1 and RPA2 to multiple nuclear foci upon induction of DNA damage. DNA damage induces an increase in nuclear levels. Together with FIGNL1, redistributed in discrete nuclear DNA damage-induced foci after ionizing radiation (IR) or camptothecin (CPT) treatment. Accumulated at sites of DNA damage in a SPIDR-dependent manner. - Information by UniProt
-
Database links
- Entrez Gene: 514749 Cow
- Entrez Gene: 403568 Dog
- Entrez Gene: 5888 Human
- Entrez Gene: 19361 Mouse
- Entrez Gene: 100008661 Rabbit
- Omim: 179617 Human
- SwissProt: P70099 Chinese hamster
- SwissProt: Q2KJ94 Cow
see all -
Alternative names
- BRCA1/BRCA2 containing complex, subunit 5 antibody
- BRCC 5 antibody
- BRCC5 antibody
see all
Images
-
All lanes : Anti-Rad51 antibody (ab176458) at 1/1000 dilution
Lane 1 : MCF7 (human breast adenocarcinoma cell line) cell lysate
Lane 2 : NIH3T3 (Mouse embryo fibroblast cell line) cell lysate
Lane 3 : CHO (Chinese hamster ovary cell line) cell lysate
Lane 4 : Xenopus laevis egg
Lysates/proteins at 40 µg per lane.
Predicted band size: 36 kDa -
Immunofluorescence detection of Rad51 foci formation after X-ray irradiation in GM0637 cells with ab176458 at 1/10000 dilution (left panels) and 1/1000 dilution (right panels). The secondary antibody, anti-rabbit Alexa 488 was used at 1/10000 dilution.
Cells were irradiated by X-rays at 2 Gy, grown for 1 hr, fixed with 4% paraformaldehyde in 1x PBS for 10 min, washed 3 times with PBS for 3 min, permealized by treatment with 0.5% Triton for 5 min, washed 3 times with PBS for 3 min, incubated with ab176458 for 30 min at 37°C, washed 3 times with PBS for 3 min, incubated with secondary antibody for 30 min at 37°C, washed 3 times with PBS for 3 min, stained with Hoechst for 1 min and mounted.
The pictures were by courtesy of Prof. S. Tashiro and Dr. K. Kono at Hiroshima University.
-
Anti-Rad51 antibody (ab176458) at 1/1000 dilution + Crude HeLa cell extracts at 10 µg
Secondary
Goat anti-Rabbit IgG conjugated to HRP at 1/20000 dilution
Predicted band size: 36 kDa -
ab176458 (20 µg) was incubated with 20 μg of HeLa cell extract, and precipitated with 20 μg of proteinA-beads. The sample was dissociated from the precipitate by heating in SDS-sample buffer and analyzed by western blotting with anti-Rad51 antiserum (chicken, ab63802) at 1/1000 dilution. As secondary antibody, anti-chicken IgG antibody (rabbit) was used at 1/10000 dilution.
-
Immunohistological staining of Rad51 protein in mouse testis using ab176458. A section of formalin fixed and paraffin embedded mouse testis was treated with ab176458 at 1/100 dilution after deparaffization and antigen retrieval. The secondary antibody, Alexa Fluor® 647conjugated anti-rabbit IgG was used at 1/1,000 dilution (top left). The sample was counter-stained with DAPI (top right) and the merged image is shown (bottom left). The white light image of the same region is shown on the bottom right.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (21)
ab176458 has been referenced in 21 publications.
- Chansard A et al. Imaging the Response to DNA Damage in Heterochromatin Domains. Front Cell Dev Biol 10:920267 (2022). PubMed: 35721488
- Zhang Q et al. Folic Acid Preconditioning Alleviated Radiation-Induced Ovarian Dysfunction in Female Mice. Front Nutr 9:854655 (2022). PubMed: 35836584
- Panday A et al. A modified CUT&RUN-seq technique for qPCR analysis of chromatin-protein interactions. STAR Protoc 3:101529 (2022). PubMed: 35928003
- Sharma AK et al. Quantification of protein enrichment at site-specific DNA double-strand breaks by chromatin immunoprecipitation in cultured human cells. STAR Protoc 4:101917 (2022). PubMed: 36520630
- Arnould C et al. Analyzing Homologous Recombination at a Genome-Wide Level. Methods Mol Biol 2153:427-438 (2021). PubMed: 32840796