Overview

  • Product name

  • Description

    Rabbit polyclonal to Rad51D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Rad51D aa 1-328.
    Sequence:

    MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKAL VALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTG EVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLL QAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTV KVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNH ITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSR QPTGFQEMVDIGTWGTSEQSATLQGDQT


    Database link: O75771

  • Positive control

    • IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Tissue specificity

    Expressed in colon, prostate, spleen, testis, ovary, thymus and small intestine. Weakly expressed in leukocytes.
  • Sequence similarities

    Belongs to the RecA family. RAD51 subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BROVCA4 antibody
    • DNA repair protein RAD51 homolog 4 antibody
    • HsTRAD antibody
    • OTTHUMP00000163851 antibody
    • OTTHUMP00000163852 antibody
    • OTTHUMP00000163853 antibody
    • R51H3 antibody
    • RA51D_HUMAN antibody
    • RAD51 homolog D (S. cerevisiae) antibody
    • RAD51 homolog D antibody
    • RAD51 like 3 (S. cerevisiae) antibody
    • RAD51 paralog D antibody
    • RAD51, S. cerevisiae, homolog of, D antibody
    • RAD51-like protein 3 antibody
    • Rad51l3 antibody
    • Recombination repair protein antibody
    • S. cerevisiae RAD51-like 3 antibody
    • TRAD antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for Rad51D using ab238579 at 1/100 dilution in immunohistochemical analysis.

References

ab238579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up