Overview

  • Product name

  • Description

    Rabbit polyclonal to RAD54
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RAD54 aa 195-339.
    Sequence:

    TLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAID GGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVI CDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLV


    Database link: Q92698

  • Positive control

    • WB: RAD54 overexpression HEK-293T cell lysate. IHC-P: Human rectum tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.
WB 1/100 - 1/250. Predicted molecular weight: 84 kDa.

Target

  • Function

    Involved in DNA repair and mitotic recombination. Functions in the recombinational DNA repair (RAD52) pathway. Dissociates RAD51 from nucleoprotein filaments formed on dsDNA. Could be involved in the turnover of RAD51 protein-dsDNA filaments (By similarity). May play also an essential role in telomere length maintenance and telomere capping in mammalian cells.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA repair and recombination protein RAD54 like antibody
    • DNA repair and recombination protein RAD54-like antibody
    • hHR 54 antibody
    • hHR54 antibody
    • HR 54 antibody
    • HR54 antibody
    • hRAD 54 antibody
    • hRAD54 antibody
    • RAD 54A antibody
    • RAD 54L antibody
    • RAD54 (S. cerevisiae) like antibody
    • RAD54 homolog antibody
    • RAD54 like (S. cerevisiae) antibody
    • RAD54 like antibody
    • RAD54 like protein antibody
    • RAD54_HUMAN antibody
    • RAD54A antibody
    • RAD54L antibody
    see all

Images

  • All lanes : Anti-RAD54 antibody (ab224763) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : RAD54 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 84 kDa

  • Paraffin-embedded human rectum tissue stained for RAD54 using ab224763 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for RAD54 (green) using ab224763 at 4 µg/ml in ICC/IF.

References

ab224763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up