Overview

  • Product name

    Anti-RAD9B antibody - C-terminal
  • Description

    Rabbit polyclonal to RAD9B - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Dog, Pig
  • Immunogen

    Synthetic peptide within Human RAD9B aa 239-288 (C terminal). The exact sequence is proprietary.
    Sequence:

    ATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCL


    Database link: Q6WBX8-1

  • Positive control

    • Human fetal thymus lysate.
  • General notes

    Previously labelled as RAD9 homolog B. 

Properties

Applications

Our Abpromise guarantee covers the use of ab186441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.

Target

Images

  • Anti-RAD9B antibody - C-terminal (ab186441) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Predicted band size: 46 kDa

References

ab186441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up