Overview

  • Product name

  • Description

    Rabbit polyclonal to RAG1AP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human RAG1AP1 aa 34-67.
    Sequence:

    RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG


    Database link: Q9BRV3

  • Positive control

    • IHC-P: Human epididymis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.
  • Tissue specificity

    Ubiquitously expressed with highest expression in oviduct, epididymis and intestine.
  • Sequence similarities

    Belongs to the SWEET sugar transporter family.
    Contains 2 MtN3/slv domains.
  • Cellular localization

    Golgi apparatus membrane. Cell membrane. May also localize to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • HsSWEET1 antibody
    • Probable sugar transporter RAG1AP1 antibody
    • RAG1 activating protein 1 antibody
    • RAG1-activating protein 1 antibody
    • RAG1AP1 antibody
    • Recombination activating gene 1 activating protein 1 antibody
    • RP11-540D14.5 antibody
    • RZPDo834D038D antibody
    • SCP antibody
    • SLC50A1 antibody
    • slv antibody
    • Solute carrier family 50 (sugar efflux transporter) member 1 antibody
    • Solute carrier family 50 (sugar transporter) member 1 antibody
    • Solute carrier family 50 member 1 antibody
    • Stromal cell protein antibody
    • Sugar transporter SWEET1 antibody
    • SWEET1 antibody
    • SWET1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human epididymis tissue stained for RAG1AP1 with ab244358 at a 1/20 dilution in immunohistochemical analysis.

References

ab244358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up