Anti-RAI2 antibody (ab247100)
Key features and details
- Rabbit polyclonal to RAI2
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RAI2 antibody
See all RAI2 primary antibodies -
Description
Rabbit polyclonal to RAI2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human RAI2 aa 437-514.
Sequence:AKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEE SMGNAEPLRKPIKNRSIKLKKVNSQEIH
Database link: Q9Y5P3 -
Positive control
- ICC/IF: HEK-293 cells. IHC-P: Human cerebral cortex tissue. WB: RT4 and U-251 MG whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247100 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 57 kDa. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
The specific function of RAI2 (Retinoic acid induced 2) has not yet been determined. However, it is suggested that it may have a role in development since retinoic acid is involved in vertebrate anteroposterior axis formation and cellular differentiation, and has been shown to modulate gene expression controlling early embryonic development. -
Database links
- Entrez Gene: 10742 Human
- Omim: 300217 Human
-
Alternative names
- RAI 2 antibody
- Retinoic acid induced 2 antibody
- Retinoic acid induced protein 2 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAI2 antibody (ab247100)
Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for RAI2 using ab247100 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-RAI2 antibody (ab247100) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 57 kDa -
PFA-fixed, Triton X-100 permeabilized HEK-293 (human epithelial cell line from embryonic kidney) cells stained for RAI2 (green) using ab247100 at 4μg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247100 has not yet been referenced specifically in any publications.