Overview

  • Product name

  • Description

    Rabbit polyclonal to RALA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Saguinus oedipus
  • Immunogen

    Recombinant fragment corresponding to Human RALA aa 1-203.
    Sequence:

    MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADS YRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMES FAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWN VNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIR ERC


    Database link: P11233

  • Positive control

    • IHC-P: Human adrenal gland tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/20 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Multifuntional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. Key regulator of LPAR1 signaling and competes with ADRBK1 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications

    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localization

    Cell surface. Cell membrane. Cleavage furrow. Midbody. Prior to LPA treatment found predominantly at the cell surface and in the presence of LPA co-localizes with LPAR1 and LPAR2 in the endocytic vesicles. During early cytokinesis localizes at the cleavage furrow membrane. Colocalizes with EXOC2 at the early midbody ring and persists there till maturation of the midbody.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC48949 antibody
    • Ral a antibody
    • Ral A protein antibody
    • RAL antibody
    • RALA antibody
    • RALA_HUMAN antibody
    • Ras family small GTP binding protein RALA antibody
    • RAS like protein A antibody
    • Ras related protein RalA antibody
    • Ras-related protein Ral-A antibody
    • v ral simian leukemia viral oncogene homolog A (ras related) antibody
    • v ral simian leukemia viral oncogene homolog A antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for RALA using ab236314 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2 Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling RALA using ab236314 (green) at 1/100 dilution in ICC/IF.

    Cells were blocked in 10% normal goat serum and incubated with primary antibody overnight at 4°C. The secondary antibody was Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L). Counter stained with DAPI (blue).

References

ab236314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up