Overview

  • Product name

  • Description

    Rabbit polyclonal to RALBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse RALBP1 aa 192-380. N-terminal tag. (Expressed in E.coli).
    Sequence:

    VPLVDAVERTMMYDGVRLPAVFRECVDYMEKHGMKCEGVYRVSGIKSKVD ELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEAC GKTTEMEKVQEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQN ISIVLSPTVQISNRVLYVLFTHVQELFGTVVLKQVTRPL


    Database link: Q62172

  • Positive control

    • WB: Recombinant mouse RALBP1 and mouse serum. IHC-P: Mouse liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 75 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin.
  • Tissue specificity

    Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.
  • Sequence similarities

    Contains 1 Rho-GAP domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • RLIP1 antibody
    • 76 kDa Ral-interacting protein antibody
    • 76-kDa Ral-interacting protein antibody
    • Dinitrophenyl S-glutathione ATPase antibody
    • DNP-SG ATPase antibody
    • Ral-interacting protein 1 antibody
    • Ral-interacting protein 1, 76-KD antibody
    • RalA-binding protein 1 antibody
    • RalBP1 antibody
    • RBP1_HUMAN antibody
    • RIP1 antibody
    • RLIP1 antibody
    • RLIP76 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for RALBP1 using ab231900 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RALBP1 antibody (ab231900) at 1 µg/ml + Recombinant mouse RALBP1 protein

    Developed using the ECL technique.

    Predicted band size: 75 kDa
    Observed band size: 25 kDa
    why is the actual band size different from the predicted?

  • Anti-RALBP1 antibody (ab231900) at 1 µg/ml + Mouse serum

    Developed using the ECL technique.

    Predicted band size: 75 kDa

References

ab231900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (MDA231 tumors taken out Balb/C nude mice)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate pH 6
Permeabilization
No
Specification
MDA231 tumors taken out Balb/C nude mice
Blocking step
Innovex Background Buster as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Feb 28 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up