Overview

  • Product name

  • Description

    Rabbit polyclonal to RALBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human RALBP1 aa 403-499. (Expressed in E.coli)
    Sequence:

    RRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECE TKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQF LRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEEL QIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAE QQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKE TSI


    Database link: Q15311

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant RALBP1 protein; Human lung and mouse lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 76 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin.
  • Tissue specificity

    Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.
  • Sequence similarities

    Contains 1 Rho-GAP domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • RLIP1 antibody
    • 76 kDa Ral-interacting protein antibody
    • 76-kDa Ral-interacting protein antibody
    • Dinitrophenyl S-glutathione ATPase antibody
    • DNP-SG ATPase antibody
    • Ral-interacting protein 1 antibody
    • Ral-interacting protein 1, 76-KD antibody
    • RalA-binding protein 1 antibody
    • RalBP1 antibody
    • RBP1_HUMAN antibody
    • RIP1 antibody
    • RLIP1 antibody
    • RLIP76 antibody
    see all

Images

  • All lanes : Anti-RALBP1 antibody (ab233126) at 2 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Mouse lung tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 76 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for RALBP1 using ab233126 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-RALBP1 antibody (ab233126) at 2 µg/ml + Recombinant RALBP1 protein.

    Predicted band size: 76 kDa

References

ab233126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up