Overview

  • Product name

    Anti-RALBP1 antibody - C-terminal
    See all RALBP1 primary antibodies
  • Description

    Rabbit polyclonal to RALBP1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide within Human RALBP1 aa 605-655 (C terminal). The exact sequence is proprietary. (NP_006779.1).
    Sequence:

    AQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETS I


    Database link: Q15311

  • Positive control

    • 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab191167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 76 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin.
  • Tissue specificity

    Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.
  • Sequence similarities

    Contains 1 Rho-GAP domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • RLIP1 antibody
    • 76 kDa Ral-interacting protein antibody
    • 76-kDa Ral-interacting protein antibody
    • Dinitrophenyl S-glutathione ATPase antibody
    • DNP-SG ATPase antibody
    • Ral-interacting protein 1 antibody
    • Ral-interacting protein 1, 76-KD antibody
    • RalA-binding protein 1 antibody
    • RalBP1 antibody
    • RBP1_HUMAN antibody
    • RIP1 antibody
    • RLIP1 antibody
    • RLIP76 antibody
    see all

Images

  • All lanes : Anti-RALBP1 antibody - C-terminal (ab191167) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 76 kDa


    Exposure time: 30 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of RALBP1 in immunoprecipitates of 293T whole cell lysate prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab191167 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab191167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up