Overview

  • Product name

  • Description

    Rabbit polyclonal to RAMP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RAMP1 aa 27-117.
    Sequence:

    CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHM AEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS


    Database link: O60894

  • Positive control

    • HepG2 cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab194787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 17 kDa.

Target

  • Function

    Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
  • Tissue specificity

    Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
  • Sequence similarities

    Belongs to the RAMP family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcitonin receptor like receptor activity modifying protein 1 antibody
    • Calcitonin-receptor-like receptor activity-modifying protein 1 antibody
    • CRLR activity modifying protein 1 antibody
    • CRLR activity-modifying protein 1 antibody
    • Ramp1 antibody
    • RAMP1_HUMAN antibody
    • receptor (calcitonin) activity modifying protein 1 antibody
    • Receptor (G protein coupled) activity modifying protein 1 antibody
    • Receptor activity modifying protein 1 [Precursor] antibody
    • Receptor activity-modifying protein 1 antibody
    see all

Images

  • Anti-RAMP1 antibody (ab194787) at 1/500 dilution + HepG2 cell extract

    Predicted band size: 17 kDa

References

ab194787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up