Overview

  • Product name

  • Description

    Rabbit polyclonal to RanBP9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Horse, Chimpanzee, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human RanBP9 aa 125-175. The exact sequence is proprietary.
    Sequence:

    AGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDK F


    Database link: Q96S59

  • Positive control

    • HeLa, 293T, and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab205954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 78 kDa.

Target

  • Function

    May act as an adapter protein to couple membrane receptors to intracellular signaling pathways. May be involved in signaling of ITGB2/LFA-1 and other integrins. Enhances HGF-MET signaling by recruiting Sos and activating the Ras pathway. Involved in activation of androgen and glucocorticoid receptor in the presence of their cognate hormones. Stabilizes TP73 isoform Alpha, probably by inhibiting its ubiquitination, and increases its proapoptotic activity. Inhibits the kinase activity of DYRK1A and DYRK1B. Inhibits FMR1 binding to RNA.
  • Tissue specificity

    Ubiquitously expressed, with highest levels in testes, placenta, heart, and muscle, and lowest levels in lung. Within the brain, expressed predominantly by neurons in the gray matter of cortex, the granular layer of cerebellum and the Purkinje cells.
  • Sequence similarities

    Belongs to the RANBP9/10 family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 CTLH domain.
    Contains 1 LisH domain.
  • Domain

    The SPRY domain mediates the interaction with MET, AR, and CDC2L1.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated in response to stress. Can be phosphorylated by the cleaved p110 form of CDC2L1 (p110C).
    Ubiquitinated. Polyubiquitination targets the protein for rapid degradation via the ubiquitin system. Can be deubiquitinated by USP11.
  • Cellular localization

    Nucleus. Cytoplasm. A phosphorylated form is associated with the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell antigen receptor Ig beta associated protein 1 antibody
    • BPM 90 antibody
    • BPM L antibody
    • BPM-L antibody
    • BPM90 antibody
    • BPML antibody
    • IBAP 1 antibody
    • Imp 9 antibody
    • Importin 9 antibody
    • Novel centrosomal protein RanBPM antibody
    • RAN binding protein 9 antibody
    • Ran binding protein centrosomal antibody
    • Ran Binding Protein in the Microtubule organizing center antibody
    • Ran binding protein M antibody
    • Ran BP9 antibody
    • Ran-binding protein 9 antibody
    • Ran-binding protein M antibody
    • RANB9_HUMAN antibody
    • RanBP 7 antibody
    • RANBP 9 antibody
    • RanBP7 antibody
    • RanBP9 antibody
    • RanBPM antibody
    see all

Images

  • Detection of RanBP9 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab205954 at 6 µg/mg lysate for IP. For WB detection an ab205954 was used at 0.4 µg/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.

  • All lanes : Anti-RanBP9 antibody (ab205954) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 78 kDa


    Exposure time: 30 seconds

References

ab205954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up