Overview

  • Product name

  • Description

    Rabbit polyclonal to RANK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RANK aa 60-209.
    Sequence:

    CTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTP RRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYF SDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHV


    Database link: Q9Y6Q6

  • Positive control

    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
  • Tissue specificity

    Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
  • Involvement in disease

    Defects in TNFRSF11A are the cause of familial expansile osteolysis (FEO) [MIM:174810]. FEO is a rare autosomal dominant bone disorder characterized by focal areas of increased bone remodeling. The osteolytic lesions develop usually in the long bones during early adulthood. FEO is often associated with early onset deafness and loss of dentition.
    Defects in TNFRSF11A are a cause of Paget disease of bone type 2 (PDB2) [MIM:602080]; also known as familial Paget disease of bone. PDB2 is a bone-remodeling disorder with clinical similarities to FEO. Unlike FEO, however, affected individuals have involvement of the axial skeleton with lesions in the spine, pelvis and skull.
    Defects in TNFRSF11A are the cause of osteopetrosis autosomal recessive type 7 (OPTB7) [MIM:612301]; also called osteoclast-poor osteopetrosis with hypogammaglobulinemia. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. OPTB7 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development. OPTB7 is associated with hypogammaglobulinemia.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 265 antibody
    • CD265 antibody
    • FEO antibody
    • LOH18CR1 antibody
    • Loss of heterozygosity 18 chromosomal region 1 antibody
    • mRANK antibody
    • ODFR antibody
    • OFE antibody
    • OPTB7 antibody
    • Osteoclast differentiation factor receptor antibody
    • OSTS antibody
    • Paget disease of bone 2 antibody
    • PDB 2 antibody
    • PDB2 antibody
    • RANK antibody
    • Receptor activator of NF KB antibody
    • Receptor activator of NF-KB antibody
    • receptor activator of nuclear factor kappa B antibody
    • TNF receptor superfamily member 11a antibody
    • TNFRSF11A antibody
    • TNR11_HUMAN antibody
    • TRANCER antibody
    • Tumor necrosis factor receptor superfamily member 11a NFKB activator antibody
    • Tumor necrosis factor receptor superfamily member 11a activator of NFKB antibody
    • Tumor necrosis factor receptor superfamily member 11A antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RANK (green) using ab222215 at 4 µg/ml in ICC/IF.

References

ab222215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up