Overview

  • Product name

    Anti-RANKL antibody [C1]
    See all RANKL primary antibodies
  • Description

    Mouse monoclonal [C1] to RANKL
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat RANKL aa 106-240. N-terminal His tag. Expressed in E. coli.
    Sequence:

    ESEDTEALPDSCRRMKQAFQGAVQRELQHIVGPQRFSGVPAMMEGSWLDV ARRGKPEAQPFAHLTINAADIPSGSHKVSLSSWYHDRGWAKISNMTLSNG KLRVNQDGFYYLYANICFRHHETSGSVPADYLQLM


    Database link: Q9ESE2

  • Positive control

    • IHC-P: Rat spinal cord tissue. WB: Recombinant rat RANKL protein. HEK-293T cell lysate. Rat thymus tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab239607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 35 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
  • Tissue specificity

    Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
  • Involvement in disease

    Defects in TNFSF11 are the cause of osteopetrosis autosomal recessive type 2 (OPTB2) [MIM:259710]; also known as osteoclast-poor osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB2 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD254 antibody
    • hRANKL2 antibody
    • ODF antibody
    • OPGL antibody
    • OPTB2 antibody
    • Osteoclast differentiation factor antibody
    • Osteoprotegerin ligand antibody
    • RANKL antibody
    • Receptor activator of nuclear factor kappa B ligand antibody
    • Receptor activator of nuclear factor kappa-B ligand antibody
    • sOdf antibody
    • TNF related activation induced cytokine antibody
    • TNF-related activation-induced cytokine antibody
    • TNF11_HUMAN antibody
    • TNFSF 11 antibody
    • Tnfsf11 antibody
    • TRANCE antibody
    • Tumor necrosis factor (ligand) superfamily member 11 antibody
    • Tumor necrosis factor ligand superfamily member 11 antibody
    • Tumor necrosis factor ligand superfamily member 11, soluble form antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for RANKL with ab239607 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RANKL antibody [C1] (ab239607) at 5 µg/ml + Rat thymus tissue lysate

    Secondary
    HRP-Goat Anti-Mouse IgG

    Predicted band size: 35 kDa

  • Anti-RANKL antibody [C1] (ab239607) at 5 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 35 kDa

  • Anti-RANKL antibody [C1] (ab239607) at 5 µg/ml + Recombinant rat RANKL protein

    Predicted band size: 35 kDa

References

ab239607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up