Overview

  • Product name

  • Description

    Rabbit polyclonal to RANTES
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Horse, Guinea pig, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human RANTES aa 24-91.
    Sequence:

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVC ANPEKKWVREYINSLEMS


    Database link: P13501

  • Positive control

    • Jurkat, U937 and Mouse thymus extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 10 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
  • Tissue specificity

    T-cell and macrophage specific.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
    The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta chemokine RANTES antibody
    • Beta chemokine RANTES precursor antibody
    • C C motif chemokine 5 antibody
    • CCL 5 antibody
    • CCL5 antibody
    • CCL5_HUMAN antibody
    • Chemokine (C C motif) ligand 5 antibody
    • Chemokine CC Motif Ligand 5 antibody
    • D17S136E antibody
    • EoCP antibody
    • Eosinophil chemotactic cytokine antibody
    • MGC17164 antibody
    • RANTES(4-68) antibody
    • Regulated upon activation normally T expressed and presumably secreted antibody
    • SCYA 5 antibody
    • SCYA5 antibody
    • SIS delta antibody
    • SIS-delta antibody
    • SISd antibody
    • Small inducible cytokine A5 (RANTES) antibody
    • Small inducible cytokine A5 antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 5 antibody
    • Small-inducible cytokine A5 antibody
    • T cell specific protein p288 antibody
    • T cell specific protein RANTES antibody
    • T cell specific RANTES protein antibody
    • T cell-specific protein P228 antibody
    • T-cell-specific protein RANTES antibody
    • TCP 228 antibody
    • TCP228 antibody
    see all

Images

  • All lanes : Anti-RANTES antibody (ab189841) at 1/500 dilution

    Lane 1 : Jurkat cell extract
    Lane 2 : U937 cell extract
    Lane 3 : Mouse thymus extract

    Predicted band size: 10 kDa

References

This product has been referenced in:

  • Liu F  et al. Hyperoside inhibits proinflammatory cytokines in human lung epithelial cells infected with Mycoplasma pneumoniae. Mol Cell Biochem 453:179-186 (2019). Read more (PubMed: 30350306) »
  • Nunes P  et al. A Stillborn Multiple Organs' Investigation from a Maternal DENV-4 Infection: Histopathological and Inflammatory Mediators Characterization. Viruses 11:N/A (2019). Read more (PubMed: 30986974) »
See all 4 Publications for this product

Customer reviews and Q&As

Answer

According to the RANTES uniprot file here (http://www.uniprot.org/uniprot/P13501) the signal peptide cleaved in mature RANTES is amino acids 1-23. The resulting cleaved form amino acids 24-91 is 7.9 kDa. According to the same uniprot file, the protein can homodimerize, and a dimer of the cleaved form would be 15.8 kDa. My interpretation is that this 15.8 kDa homodimer is the band seen in the western blot for ab189841.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up