Overview

  • Product name
  • Description
    Rabbit polyclonal to RAO
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human RAO aa 1-756.
    Sequence:

    MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHP GQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLP PKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVGPLPHPSYMRD VTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGS TLAAVHATPRGLRSGDRATWMALYHNISGVGLFLHPVGLELLLDHRALDP AHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQG ERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPY QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA SSALVVRSVSSVGNYDYIWDFVLYPNGALEGRVHATGYINTAFLKGGEEG LLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWN PEHWLQRPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYR IQIHSPLGIHIPLESDMERALSWGRYQLVVTQRKEEESQSSSIYHQNDIW TPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPP FSYHGF


    Database link: NP_033720.2

  • Positive control
    • RAO transfected 293T cell lysate.
  • General notes

    Previously labelled as AOC2. 

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 84 kDa.

Target

  • Function
    Has a monoamine oxidase activity with substrate specificity for 2-phenylethylamine and tryptamine. May play a role in adipogenesis. May be a critical modulator of signal transmission in retina.
  • Tissue specificity
    Expressed in many tissues with much higher expression in retina. Isoform 1 and isoform 2 are expressed in adipose tissue, whereas isoform 1 only seems to be present in thymus, and isoform 2 only in testis.
  • Sequence similarities
    Belongs to the copper/topaquinone oxidase family.
  • Post-translational
    modifications
    Topaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue.
  • Cellular localization
    Cell membrane. Present on the surface of the cells and Cytoplasm. Either not translocated to the plasma membrane or below detection level.
  • Information by UniProt
  • Database links
  • Alternative names
    • Amine oxidase [copper containing] antibody
    • Amine oxidase [copper-containing] antibody
    • Amine oxidase copper containing 2 (retina specific) antibody
    • Amine oxidase copper containing 2 antibody
    • AOC2 antibody
    • AOC2_HUMAN antibody
    • DAO2 antibody
    • RAO antibody
    • Retina specific copper amine oxidase antibody
    • Retina-specific copper amine oxidase antibody
    • Semicarbazide-sensitive amine oxidase antibody
    • SSAO antibody
    see all

Images

  • All lanes : Anti-RAO antibody (ab171801) at 1 µg/ml

    Lane 1 : ROA transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Predicted band size: 84 kDa

References

ab171801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up