Overview

  • Product name

  • Description

    Rabbit polyclonal to RAP1GAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human RAP1GAP aa 501-601.
    Sequence:

    IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKN RAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT P


    Database link: P47736

  • Positive control

    • IHC-P: Mouse hippocampus, globus pallidus, hypothalamus, cingulate cortex and midbrain tissue. Human kidney, cerebellum, cerebral cortex and hippocampus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.
  • Tissue specificity

    Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues.
  • Sequence similarities

    Contains 1 GoLoco domain.
    Contains 1 Rap-GAP domain.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0474 antibody
    • Rap1 GTPase activating protein 1 antibody
    • RAP1 GTPase activating protein antibody
    • Rap1 GTPase-activating protein 1 antibody
    • RAP1GA1 antibody
    • Rap1ga1 protein antibody
    • Rap1GAP antibody
    • Rap1GAP1 antibody
    • RAP1GAPII antibody
    • RAPGAP antibody
    • RPGP1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for RAP1GAP with ab244259 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebellum tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse hippocampus tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse globus pallidus tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse hypothalamus tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse cingulate cortex tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human hippocampus tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse midbrain tissue stained for RAP1GAP with ab244259 at a 1/200 dilution in immunohistochemical analysis.

References

ab244259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up