Anti-RAP1GDS1 antibody (ab224413)
Key features and details
- Rabbit polyclonal to RAP1GDS1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RAP1GDS1 antibody
See all RAP1GDS1 primary antibodies -
Description
Rabbit polyclonal to RAP1GDS1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human RAP1GDS1 aa 213-337.
Sequence:ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVE AGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGG KGSVFQRVLSWIPSNNHQLQLAGA
Database link: P52306 -
Positive control
- WB: MOLT-4 Human cell line. IHC-P: Human cerebral cortex tissue. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224413 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 66 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Stimulates GDP/GTP exchange reaction of a group of small GTP-binding proteins (G proteins) including Rap1a/Rap1b, RhoA, RhoB and KRas, by stimulating the dissociation of GDP from and the subsequent binding of GTP to each small G protein. -
Sequence similarities
Contains 5 ARM repeats. - Information by UniProt
-
Database links
- Entrez Gene: 282516 Cow
- Entrez Gene: 5910 Human
- Omim: 179502 Human
- SwissProt: Q04173 Cow
- SwissProt: P52306 Human
- Unigene: 132858 Human
-
Alternative names
- Exchange factor smgGDS antibody
- GDP dissociation stimulator 1 antibody
- GDS1 antibody
see all
Images
-
Anti-RAP1GDS1 antibody (ab224413) + MOLT-4 cell line
Predicted band size: 66 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAP1GDS1 antibody (ab224413)
Paraffin-embedded human cerebral cortex tissue stained for RAP1GDS1 with ab224413 (1/50) in immunohistochemical analysis
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RAP1GDS1 (green) using ab224413 (4 µg/ml) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224413 has not yet been referenced specifically in any publications.