Anti-RAP1GDS1 antibody (ab224413)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RAP1GDS1 antibody
See all RAP1GDS1 primary antibodies -
Description
Rabbit polyclonal to RAP1GDS1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow
-
Immunogen
Recombinant fragment corresponding to Human RAP1GDS1 aa 213-337.
Sequence:ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVE AGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGG KGSVFQRVLSWIPSNNHQLQLAGA
Database link: P52306 -
Positive control
- WB: RT4, U-251 MG sp, NIH/3T3 and NBT-II cell lysate; human liver and tonsil tissue lysate. IHC-P: Human cerebral cortex tissue. ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224413 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | 1/100 - 1/250. Predicted molecular weight: 66 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Stimulates GDP/GTP exchange reaction of a group of small GTP-binding proteins (G proteins) including Rap1a/Rap1b, RhoA, RhoB and KRas, by stimulating the dissociation of GDP from and the subsequent binding of GTP to each small G protein. -
Sequence similarities
Contains 5 ARM repeats. - Information by UniProt
-
Database links
- Entrez Gene: 282516 Cow
- Entrez Gene: 5910 Human
- Entrez Gene: 229877 Mouse
- Entrez Gene: 310909 Rat
- Omim: 179502 Human
- SwissProt: Q04173 Cow
- SwissProt: P52306 Human
- Unigene: 132858 Human
-
Alternative names
- Exchange factor smgGDS antibody
- GDP dissociation stimulator 1 antibody
- GDS1 antibody
see all
Images
-
Western blot - Anti-RAP1GDS1 antibody (ab224413)All lanes : Anti-RAP1GDS1 antibody (ab224413) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Predicted band size: 66 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAP1GDS1 antibody (ab224413)Paraffin-embedded human cerebral cortex tissue stained for RAP1GDS1 with ab224413 (1/50) in immunohistochemical analysis
-
Western blot - Anti-RAP1GDS1 antibody (ab224413)All lanes : Anti-RAP1GDS1 antibody (ab224413) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate
Predicted band size: 66 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-RAP1GDS1 antibody (ab224413)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RAP1GDS1 (green) using ab224413 (4 µg/ml) in ICC/IF.
Datasheets and documents
References
ab224413 has not yet been referenced specifically in any publications.
