Overview

  • Product name

  • Description

    Rabbit polyclonal to RAP2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human RAP2B aa 1-183.
    Sequence:

    MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSP SVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQI IRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNK ASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL


    Database link: P61225

  • Positive control

    • IHC-P: Human brain and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
  • Tissue specificity

    Expressed in red blood cells (at protein level).
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Domain

    The effector domain mediates the interaction with RUNDC3A.
  • Post-translational
    modifications

    Palmitoylated. Palmitoylation is required for association with recycling endosome membranes and activation of TNIK.
  • Cellular localization

    Recycling endosome membrane. Associated with red blood cells-released vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC20484 antibody
    • RAP 2B antibody
    • RAP2A antibody
    • Rap2b antibody
    • RAP2B member of RAS oncogene family antibody
    • RAP2B_HUMAN antibody
    • Ras family small GTP binding protein RAP2B antibody
    • Ras related protein RAP 2B antibody
    • Ras related protein RAP2B antibody
    • Ras-related protein Rap-2b antibody
    • Small GTP binding protein antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for RAP2B using ab234791 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for RAP2B using ab234791 at 1/100 dilution in immunohistochemical analysis.

References

ab234791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up