Overview

  • Product name

  • Description

    Rabbit polyclonal to RAP80
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human RAP80 aa 207-301.
    Sequence:

    PVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRH CLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLE


    Database link: Q96RL1

  • Positive control

    • IHC-P: Human lymph node, colon, testis and cerebral cortex tissue. WB: RAP80 transfected HEK-293T cell lysate ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. Plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. Also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. May interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. May indirectly Act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1.
  • Tissue specificity

    Expressed in testis, ovary, thymus and heart. Expressed in germ cells of the testis.
  • Sequence similarities

    Belongs to the RAP80 family.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
  • Domain

    The UIM-linker region between the 2 UIM repeats determines the selectivity for 'Lys-63'-linked ubiquitin. The length of the linker is important. The linker reduces the flexibility between the UIM repeats and promotes high-affinity and linkage-selective interactions.
    The Abraxas-interacting region (AIR) mediates the interaction with FAM175A/Abraxas.
  • Post-translational
    modifications

    Sumoylated.
    Phosphorylated upon DNA damage by ATM or ATR.
  • Cellular localization

    Nucleus. Localizes at sites of DNA damage at double-strand breaks.
  • Information by UniProt
  • Database links

  • Alternative names

    • BRCA1-A complex subunit RAP80 antibody
    • Nuclear zinc finger protein RAP80 antibody
    • OTTHUMP00000161441 antibody
    • OTTHUMP00000223372 antibody
    • OTTHUMP00000223374 antibody
    • RAP80 antibody
    • Receptor associated protein 80 antibody
    • Receptor-associated protein 80 antibody
    • Retinoid X receptor interacting protein 110 antibody
    • Retinoid x receptor interacting protein antibody
    • Retinoid X receptor-interacting protein 110 antibody
    • RIP110 antibody
    • Rxrip110 antibody
    • Ubiquitin interaction motif containing 1 antibody
    • Ubiquitin interaction motif containing protein 1 antibody
    • Ubiquitin interaction motif-containing protein 1 antibody
    • UIMC1 antibody
    • UIMC1_HUMAN antibody
    • X2HRIP110 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for RAP80 using ab244464 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-RAP80 antibody (ab244464) at 0.4 µg/ml

    Lane 1 : Vector only transfected control.
    Lane 2 : RAP80 transfected HEK-293T cell lysate
  • Paraffin-embedded human cerebral cortex tissue stained for RAP80 using ab244464 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human colon tissue stained for RAP80 using ab244464 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human lymph node tissue stained for RAP80 using ab244464 at 1/20 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for RAP80 (green) using ab244464 at 4 μg/ml in ICC/IF.

References

ab244464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up