Overview

  • Product name
  • Description
    Mouse polyclonal to Raptor
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human Raptor aa 1-379.
    Sequence:

    MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWR MKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALE TIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHY NGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAG LIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATE LLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF LLAERIMRSYNCTPVSSPRLPPTYMHAMW


    Database link: AAH64515.1

  • Positive control
    • Raptor transfected 293T cell lysate; HeLa cells

Properties

Applications

Our Abpromise guarantee covers the use of ab169506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals; functions as a scaffold for recruiting mTORC1 substrates. mTORC1 is activated in response to growth factors or amino-acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino-acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation.
  • Tissue specificity
    Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta.
  • Sequence similarities
    Belongs to the WD repeat RAPTOR family.
    Contains 7 WD repeats.
  • Cellular localization
    Cytoplasm. Lysosome. Targeting to lysosomes depends on amino acid availability.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA1303 antibody
    • KOG1 antibody
    • Mip1 antibody
    • P150 target of rapamycin (TOR) scaffold protein antibody
    • p150 target of rapamycin (TOR) scaffold protein containing WD repeats antibody
    • P150 target of rapamycin (TOR)-scaffold protein antibody
    • Raptor antibody
    • Regulatory associated protein of mTOR antibody
    • Regulatory associated protein of MTOR complex 1 antibody
    • Regulatory-associated protein of mTOR antibody
    • RPTOR antibody
    • RPTOR_HUMAN antibody
    see all

Images

  • All lanes : Anti-Raptor antibody (ab169506) at 1 µg/ml

    Lane 1 : Raptor transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 43 kDa

  • Immunofluorescent analysis of HeLa cells labeling Raptor with ab169506 at 10 µg/ml.

References

This product has been referenced in:
  • Bostner J  et al. Raptor localization predicts prognosis and tamoxifen response in estrogen receptor-positive breast cancer. Breast Cancer Res Treat 168:17-27 (2018). Read more (PubMed: 29128895) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up