Overview

  • Product name

  • Description

    Rabbit polyclonal to RARS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human RARS aa 1-146. Expressed in E.coli. N-terminal tags.
    Sequence:

    MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLK LKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPL LVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLP


    Database link: P54136

  • Positive control

    • IHC-P: Human colorectal cancer, prostate cancer and kidney tissues. WB: HEK-293T cell lysate; Recombinant human RARS protein.
  • General notes

     This product was previously labelled as Arginyl tRNA synthetase

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231610 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 75 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Forms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis. Modulates the secretion of AIMP1 and may be involved in generation of the inflammatory cytokine EMAP2 from AIMP1.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Domain

    The N-terminus (AA 1-72) has two regions predicted to be alpha-helical that might be involved in the multisynthetase complex assembly.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative initiation.
  • Alternative names

    • 2610011N19Rik antibody
    • 2610037E21Rik antibody
    • AL033339 antibody
    • Arginine tRNA ligase 1, cytoplasmic antibody
    • Arginine tRNA ligase antibody
    • Arginine--tRNA ligase antibody
    • Arginyl tRNA synthetase 1 antibody
    • Arginyl tRNA synthetase cytoplasmic antibody
    • Arginyl tRNA synthetase, cytoplasmic antibody
    • Arginyl-tRNA synthetase, cytoplasmic antibody
    • ArgRS antibody
    • AW985894 antibody
    • DALRD 1 antibody
    • DALRD1 antibody
    • EC 6.1.1.19 antibody
    • MGC8641 antibody
    • MGC86730 antibody
    • RARS antibody
    • SYRC_HUMAN antibody
    • wu:fa96g09 antibody
    • zgc:56050 antibody
    • zgc:86730 antibody
    see all

Images

  • Anti-RARS antibody (ab231610) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 75 kDa

  • Paraffin-embedded human colorectal cancer tissue stained for RARS using ab231610 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for RARS using ab231610 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for RARS using ab231610 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RARS antibody (ab231610) at 2 µg/ml + Recombinant human RARS protein

    Predicted band size: 75 kDa

References

ab231610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up