Overview

  • Product name

  • Description

    Rabbit polyclonal to RARS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RARS aa 201-500.
    Sequence:

    PNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIA HLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEK ADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAGFGVVLGEDKK KFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAY


    Database link: P54136

  • Positive control

    • WB: HL-60, K562 and A549 whole cell lysates. IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as Arginyl tRNA synthetase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 75 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Forms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis. Modulates the secretion of AIMP1 and may be involved in generation of the inflammatory cytokine EMAP2 from AIMP1.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Domain

    The N-terminus (AA 1-72) has two regions predicted to be alpha-helical that might be involved in the multisynthetase complex assembly.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative initiation.
  • Alternative names

    • 2610011N19Rik antibody
    • 2610037E21Rik antibody
    • AL033339 antibody
    • Arginine tRNA ligase 1, cytoplasmic antibody
    • Arginine tRNA ligase antibody
    • Arginine--tRNA ligase antibody
    • Arginyl tRNA synthetase 1 antibody
    • Arginyl tRNA synthetase cytoplasmic antibody
    • Arginyl tRNA synthetase, cytoplasmic antibody
    • Arginyl-tRNA synthetase, cytoplasmic antibody
    • ArgRS antibody
    • AW985894 antibody
    • DALRD 1 antibody
    • DALRD1 antibody
    • EC 6.1.1.19 antibody
    • MGC8641 antibody
    • MGC86730 antibody
    • RARS antibody
    • SYRC_HUMAN antibody
    • wu:fa96g09 antibody
    • zgc:56050 antibody
    • zgc:86730 antibody
    see all

Images

  • All lanes : Anti-RARS antibody (ab236788) at 1/500 dilution

    Lane 1 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 75 kDa

  • Paraffin-embedded human colon cancer tissue tissue stained for RARS using ab236788 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for RARS (green) using ab236788 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up