Overview

  • Product name

    Anti-RARS2 antibody
  • Description

    Rabbit polyclonal to RARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RARS2 aa 17-340.
    Sequence:

    LNLPPENLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPDIQVQAK RLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKS ELFSGLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVI RINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADD KSVAKAAQEFFQRLELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEY SGESFYREKSQEVLKLLESKGLLLKTIKGTAVVDLSGNGDPSSICTVMRS DGTSLYATRDLAAAIDRMDKYNFD


    Database link: Q5T160

  • Positive control

    • WB: Mouse kidney tissue lysate and HL-60 whole cell lysate. IHC-P: Human lung cancer and gastric cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 66 kDa (predicted molecular weight: 66 kDa).

Target

  • Involvement in disease

    Defects in RARS2 are the cause of pontocerebellar hypoplasia type 6 (PCH6) [MIM:611523]; also known as fatal infantile encephalopathy with mitochondrial respiratory chain defects. Pontocerebellar hypoplasia (PCH) is a heterogeneous group of disorders characterized by an abnormally small cerebellum and brainstem.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • arginine tRNA ligase antibody
    • arginyl tRNA synthetase 2 mitochondrial antibody
    • Arginyl tRNA synthetase antibody
    • Arginyl-tRNA synthetase antibody
    • ArgRS antibody
    • DALRD2 antibody
    • mitochondrial antibody
    • PCH6 antibody
    • Probable arginine tRNA ligase antibody
    • probable arginine tRNA ligase mitochondrial antibody
    • Probable arginine--tRNA ligase antibody
    • probable arginyl tRNA synthetase mitochondrial antibody
    • RARS2 antibody
    • RARSL antibody
    • SYRM_HUMAN antibody
    see all

Images

  • All lanes : Anti-RARS2 antibody (ab230274) at 1/1000 dilution

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : HL-60 (Human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 66 kDa
    Observed band size: 66 kDa

  • Paraffin-embedded human lung cancer tissue stained for RARS2 with ab230274 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for RARS2 with ab230274 at 1/100 dilution in immunohistochemical analysis.

References

ab230274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up