Overview

  • Product name

  • Description

    Rabbit polyclonal to RASA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human RASA3 aa 510-560 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RTLTLISKTVQTLGSLSKSKSASFKESYMATFYEFFNEQKYADAVKNFLD L


    Database link: Q14644

  • Positive control

    • Mouse embryo and rat tongue tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 96 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe please use dilutions of 1/50-1/200.

Target

  • Function

    Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4) with high affinity. Might be a specific IP4 receptor.
  • Sequence similarities

    Contains 1 Btk-type zinc finger.
    Contains 2 C2 domains.
    Contains 1 PH domain.
    Contains 1 Ras-GAP domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GAP III antibody
    • GAP1(IP4BP) antibody
    • GAP1IP4BP antibody
    • GAPIII antibody
    • GTPase activating protein 1 family antibody
    • GTPase activating protein III antibody
    • Inositol 1 3 4 5 tetrakisphosphate binding protein antibody
    • Inositol 1345 tetrakisphosphate binding protein antibody
    • Ins P4 binding protein antibody
    • Ins P4-binding protein antibody
    • Ins(1 3 4 5)P4 binding protein antibody
    • Ins(1345)P4 binding protein antibody
    • MGC46517 antibody
    • MGC47588 antibody
    • Ras GTPase activating protein 3 antibody
    • Ras GTPase-activating protein 3 antibody
    • RAS p21 protein activator 3 antibody
    • RASA 3 antibody
    • RASA3 antibody
    • RASA3_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse embryo tissue, labeling RASA3 using ab203873 at a 1/50 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat tongue tissue, labeling RASA3 using ab203873 at a 1/50 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up