Overview

  • Product name

  • Description

    Rabbit polyclonal to RASAL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human RASAL1 aa 460-510 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VKYLAISGFLFLRFFAPAILTPKLFDLRDQHADPQTSRSLLLLAKAVQSI G


    Database link: O95294

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

using a fluorescent secondary antibody.

When using a non fluorescent probe the recommended dilution is 1/100 – 1/500.

Target

  • Function

    Probable inhibitory regulator of the Ras-cyclic AMP pathway.
  • Tissue specificity

    Highly expressed in thyroid and adrenal medulla, lower expression in brain, spinal cord and trachea.
  • Sequence similarities

    Contains 1 Btk-type zinc finger.
    Contains 2 C2 domains.
    Contains 1 PH domain.
    Contains 1 Ras-GAP domain.
  • Information by UniProt
  • Database links

  • Form

    It localizes to cytoplasm.
  • Alternative names

    • GAP1 like protein antibody
    • MRASAL antibody
    • RAS GTPase activating protein like antibody
    • RAS protein activator like 1 (GAP1 like) antibody
    • RAS protein activator like 1 antibody
    • RASAL antibody
    • Rasal1 antibody
    • rasGAP activating like protein 1 antibody
    • RasGAP-activating-like protein 1 antibody
    • RASGAP1 LIKE antibody
    • RASL1_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling with RASAL1 with ab214321 at 1/200 dilution, followed by conjugation to the secondary antibody Goat Anti-Rabbit IgG, Cy3 conjugated used at 1/200 dilution for 40 minutes at 37°C.

References

This product has been referenced in:

  • Chen H  et al. miR-130b-5p promotes proliferation, migration and invasion of gastric cancer cells via targeting RASAL1. Oncol Lett 15:6361-6367 (2018). Read more (PubMed: 29731849) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up