Overview

  • Product name

    Anti-RASL11A antibody
  • Description

    Rabbit polyclonal to RASL11A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RASL11A aa 38-164.
    Sequence:

    VGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDTPGGVQ IQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPD SKAPVIIVGNKGDLLHARQVQTQDGIQ


    Database link: Q6T310

  • Positive control

    • Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab180997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Regulator of rDNA transcription. Acts in cooperation UBF/UBTF and positively regulates RNA polymerase I transcription.
  • Tissue specificity

    Widely expressed. Down-regulated in prostate tumors compared to normal prostate tissue. High levels found in colon tumor and normal colon tissue followed by small intestine, liver, jejunum, ileum, bladder and aorta. Lowest levels observed in endothelial cells.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Ras family.
  • Developmental stage

    Down-regulated during development of THP-1 monocytes into macrophages.
  • Cellular localization

    Nucleus > nucleolus. Associates with rDNA transcription unit throughout the cell cycle.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ras-like protein family member 11A antibody
    • RAS-like, family 11, member A antibody
    • Rasl11a antibody
    • RSLBA_HUMAN antibody

Images

  • Lanes 2-3 : Anti-RASL11A antibody (ab180997)

    Lane 1 : Marker
    Lane 2 : HEK293T cell lysate - vector only transfected
    Lane 3 : HEK293T cell lysate - overexpressing RASL11A with a C-terminal myc-DDK tag (~3.1kDa)
  • Immunohistochemical analysis of paraffin-embedded Human colon tissue, labeling RASL11A using ab180997 at a 1/50 dilution.

References

ab180997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up