Question (72790) | Anti-RASSF1a antibody [3F3] (ab23950)

Go to datasheet (ab23950)

Question

The corresponding amino acids of the first exon are:
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAH

Answer

The anti-RASSF1a ab23950 recognises the first exon and should therefore discriminate the exon1 deleted mutant to the wild type protein.

Sign up