Overview

  • Product name

  • Description

    Rabbit polyclonal to RASSF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human RASSF2 aa 190-240 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    VTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATD Y


    Database link: P50749

  • Positive control

    • Mouse brain lysate. Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

WB 1/100 - 1/1000. Predicted molecular weight: 38 kDa.

Target

  • Function

    Potential tumor suppressor. Acts as a KRAS-specific effector protein. May promote apoptosis and cell cycle arrest.
  • Tissue specificity

    Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines.
  • Sequence similarities

    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CENP 34 antibody
    • Centromere protein 34 antibody
    • Ras association (RalGDS/AF 6) domain family 2 antibody
    • Ras association (RalGDS/AF-6) domain family member 2 antibody
    • Ras association domain containing protein 2 antibody
    • Ras association domain-containing protein 2 antibody
    • RASF2_HUMAN antibody
    • RASFADIN antibody
    • RASSF2 antibody
    • RP4-599I11.1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue sections labeling RASSF2 with ab203580 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-RASSF2 antibody (ab203580) at 1/200 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : Goat anti-rabbit IgG H+L HRP conjugated at 1/3000 dilution

    Predicted band size: 38 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?

References

ab203580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up