Overview

  • Product name

  • Description

    Rabbit polyclonal to RASSF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human RASSF3 aa 40-91 conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    EKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMEL CK


    Database link: Q86WH2

  • Positive control

    • A549 lysate; Mouse brain lysates; Rat brain and Mouse kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab204117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

WB 1/100 - 1/1000. Predicted molecular weight: 28 kDa.

Target

Images

  • Anti-RASSF3 antibody (ab204117) at 1/300 dilution + A549 cell lysate

    Secondary
    anti-rabbit HRP at 1/5000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-RASSF3 antibody (ab204117) at 1/200 dilution

    Lane 1 : Mouse embryo lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : anti-rabbit HRP at 1/3000 dilution

    Predicted band size: 28 kDa
    Observed band size: 25 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Mouse kidney tissue labeling RASSF3 with ab204117 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab204117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up