Overview

  • Product name

  • Description

    Rabbit polyclonal to RASSF6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RASSF6 aa 16-103.
    Sequence:

    SDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYN IFYENQKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQ


    Database link: Q6ZTQ3

  • Positive control

    • Human kidney tissue; Human liver lysate; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 43 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    RASSF6 contains 1 Ras-associating domain and 1 SARAH domain. It may act as a Ras effector protein. There are four isoforms.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Putative RAS binding protein antibody
    • Ras association (RalGDS/AF 6) domain family 6 antibody
    • Ras association (RalGDS/AF 6) domain family member 6 antibody
    • Ras association domain containing protein 6 antibody
    • Ras association domain family member 6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling RASSF6 with ab220111 at 1/20 dilution.

  • All lanes : Anti-RASSF6 antibody (ab220111) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 43 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling RASSF6 with ab220111 at 4 µg/ml (green).  

References

ab220111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up