Overview

  • Product name

    Anti-Rb2 p130 antibody [2C8A8]
    See all Rb2 p130 primary antibodies
  • Description

    Mouse monoclonal [2C8A8] to Rb2 p130
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human Rb2 p130 aa 939-1139. (Purified from E.coli).
    Sequence:

    RNSGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQPSSAPPTPT RLTGANSDMEEEERGDLIQFYNNIYIKQIKTFAMKYSQANMDAPPLSPYP FVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNSPSKRLREI NSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGS H


    Database link: Q08999

  • Positive control

    • Human Rb2 p130 (aa939-1139) recombinant protein; Rb2 p130 (aa939-1139)-hIgGFc transfected HEK293 cell lysate; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab201943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 128 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Relevance

    Two retinoblastoma related proteins, p107 and pRb2 / p130, which are structurally and functionally similar to the product of the retinoblastoma gene (pRb / p105), were cloned by taking advantage of their ability to bind transforming proteins of DNA tumor viruses through a particular region called the "pocket domain." Like pRb, both proteins play a fundamental role in growth control. These Rb family proteins were measured in a variety of lung neoplasms. The highest percentage of undetectable levels and the tightest inverse correlation with the histological grading and with PCNA expression in the most aggressive tumor types were found for pRb2 / p130, which may suggest an important role for this protein in the pathogenesis and progression of lung cancer.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 130 kDa retinoblastoma associated protein antibody
    • FLJ26459 antibody
    • p130 antibody
    • PRB 2 antibody
    • PRB2 antibody
    • Rb 2 antibody
    • Rb2 antibody
    • RBL 2 antibody
    • RBL2 antibody
    • RBR 2 antibody
    • RBR2 antibody
    • Retinoblastoma like 2 antibody
    • Retinoblastoma like protein 2 antibody
    • Retinoblastoma related gene antibody
    see all

Images

  • Anti-Rb2 p130 antibody [2C8A8] (ab201943) at 1/500 dilution + Human Rb2 p130 (aa939-1139) recombinant protein

    Predicted band size: 128 kDa



    Expected MWt is 48.7 kDa.

  • All lanes : Anti-Rb2 p130 antibody [2C8A8] (ab201943) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Rb2 p130 (aa939-1139)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 128 kDa

  • Flow cytometric analysis of HeLa cells labeling Rb2 p130 with ab201943 at 1/200 dilution (green) compared to a negative control (red).

References

ab201943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up