Overview

  • Product name

    Anti-RBCK1 antibody [CL4289]
    See all RBCK1 primary antibodies
  • Description

    Mouse monoclonal [CL4289] to RBCK1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RBCK1 aa 60-192.
    Sequence:

    SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLAR DQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKD LTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP


    Database link: Q9BYM8

  • Epitope

    Binds to an epitope located within the peptide sequence KDMVFLDYGFPPVLQ as determined by overlapping synthetic peptides.
  • Positive control

    • HepG2 cell lysate; Human duodenum, liver, kidney, endometrium and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab219955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 58 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as an E3 ubiquitin-protein ligase, or as part of an E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteoasome. Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates. LUBAC conjugates linear polyubiquitin to IKBKG at 'Lys-285' and 'Lys-309' and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Binds polyubiquitin of different linkage types.
  • Sequence similarities

    Contains 1 B box-type zinc finger.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications

    Auto-ubiquitinated. Auto-ubiquitination leads to degradation by the proteasome.
    Phosphorylated. In vitro, phosphorylation inhibits auto-ubiquitination activity.
  • Information by UniProt
  • Database links

  • Alternative names

    • C20orf18 antibody
    • Chromosome 20 open reading frame 18 antibody
    • HBV associated factor 4 antibody
    • HBV-associated factor 4 antibody
    • Heme-oxidized IRP2 ubiquitin ligase 1 antibody
    • Hepatitis B virus X associated protein 4 antibody
    • Hepatitis B virus X-associated protein 4 antibody
    • HOIL 1L antibody
    • HOIL-1 antibody
    • HOIL-1L antibody
    • HOIL1 antibody
    • HOIL1L antibody
    • RanBP type and C3HC4 type zinc finger containing 1 antibody
    • RanBP-type and C3HC4-type zinc finger-containing protein 1 antibody
    • RBCC protein interacting with PKC1 antibody
    • Rbck1 antibody
    • RBCK2 antibody
    • RING finger protein 54 antibody
    • RNF54 antibody
    • UB7I3_HUMAN antibody
    • UBCE7IP3 antibody
    • Ubiquitin conjugating enzyme 7 interacting protein 3 antibody
    • Ubiquitin-conjugating enzyme 7-interacting protein 3 antibody
    • XAP3 antibody
    • XAP4 antibody
    • ZRANB4 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human duodenum tissue labeling RBCK1 with ab219955 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue labeling RBCK1 with ab219955 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human testis tissue labeling RBCK1 with ab219955 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling RBCK1 with ab219955 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling RBCK1 with ab219955 at 1/50 dilution.

  • Anti-RBCK1 antibody [CL4289] (ab219955) at 1/500 dilution + HepG2 cell lysate

    Predicted band size: 58 kDa

References

ab219955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up